Flocculation protein flo11
WebFlocculation protein FLO11; GPI-anchored cell surface glycoprotein (flocculin); required for pseudohyphal and invasive growth, flocculation, and biofilm formation; major determinant of colony morphology; transcription regulated by the MAPK pathway (Ste12p and Tec1p) and the cAMP pathway (Flo8p); required for formation of fibrous interconnections … WebSep 3, 2014 · X-ray structure of the N-terminal domain of the flocculin Flo11 from Saccharomyces cerevisiae. ... FLOCCULATION PROTEIN FLO11: A: 182: Saccharomyces cerevisiae S288C: Mutation(s): 0 Gene Names: FLO11, MAL5, MUC1, S1, S2, YIR019C: UniProt: Find proteins for P08640 (Saccharomyces cerevisiae (strain ATCC 204508 / …
Flocculation protein flo11
Did you know?
WebJan 15, 2024 · H. roseonigra ATCC 20624 also expressed additional structural proteins, such as actins, structural maintenance of chromosomes protein 4, and flocculation protein FLO11, to survive under sclareol stress. Three proteins, that is, 78 kDa glucose-regulated protein homolog, GTPase, and ATP synthase subunit α, were also upregulated. Webflocculation protein FLO11. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. LOC106791717 flocculation protein FLO11 [] Gene ID: 106791717, updated on 16-Feb-2024. Summary. Other designations. flocculation protein FLO11 ...
WebDec 17, 2024 · During storage and transportation after harvest, the jujube fruit is susceptible to black spot rot, which is caused by Alternaria alternata. The present study aimed to evaluate the effectiveness of the yeast Meyerozyma caribbica in controlling A. alternata in postharvest jujube fruits, and to explore the biofilm formation mechanism. The results … WebLOC117000791 flocculation protein FLO11-like [ (Swainson's thrush)] Gene ID: 117000791, updated on 3-Aug-2024.
WebFeb 1, 2012 · Abstract. The expression of the Flo11 flocculin in Saccharomyces cerevisiae offers the cell a wide range of phenotypes, depending on the strain and the … WebLOC105672034 flocculation protein FLO11-like [ (Argentine ant)] Gene ID: 105672034, updated on 7-Sep-2024. Summary Other designations. LOW QUALITY PROTEIN: flocculation protein FLO11-like ...
WebFeb 1, 2012 · Abstract. The expression of the Flo11 flocculin in Saccharomyces cerevisiae offers the cell a wide range of phenotypes, depending on the strain and the environmental conditions. The most important are pseudohyphae development, invasive growth and flocculation. The mechanism of cellular adhesion mediated by Flo11p is not well …
WebJul 18, 2010 · The Flo11p protein has the same domain structure as the other Flo proteins, but has a totally different amino acid sequence. The protein is responsible for … dynamic user vs dynamic deviceWebDec 4, 2013 · Als1 is functionally and structurally similar to the major flocculation protein in S. cerevisiae, Flo11, and is an effector of filamentation, and a mediator of adherence and flocculation . The transcriptional regulation of self-aggregation has extensively been studied in S. cerevisiae given the associated industrial applications of this phenotype. dynamic use static keyWebDec 1, 2005 · The FLO11 -encoded flocculin is required for a variety of important phenotypes in Saccharomyces cerevisiae, including flocculation, adhesion to agar and … cs 1.6 screenshotWebSep 3, 2014 · X-ray structure of the N-terminal domain of the flocculin Flo11 from Saccharomyces cerevisiae. ... FLOCCULATION PROTEIN FLO11: A: 211: Saccharomyces cerevisiae S288C: Mutation(s): 0 Gene Names: FLO11, MAL5, MUC1, S1, S2, YIR019C: UniProt: Find proteins for P08640 (Saccharomyces cerevisiae (strain ATCC 204508 / … cs1.6 russianWebLOC117000791 flocculation protein FLO11-like [ (Swainson's thrush)] Gene ID: 117000791, updated on 3-Aug-2024. dynamic validation listWebDec 18, 2024 · The Flo11/Muc1 flocculin has diverse phenotypic effects. Saccharomyces cerevisiae cells of strain background Σ1278b require Flo11p to form pseudohyphae, invade agar, adhere to plastic, and develop biofilms, but they do not flocculate. We show that S. cerevisiae var. diastaticus strains, on the other hand, exhibit Flo11-dependent … cs 1.6 server açmaWebgenome browser: aa seq: 1138 aa aa seq db search mkfqlfclfaylwqavfvaaagnspnfvqgdqgsvsvkatngcpcldfsfhaqntgtiqy nvdvtdvkwvqdniytvtihtygskqiplkslwslkiigvnspdggtfqlygfnektfki cs 1.6 server bulgaria