Phosl lectin
Webfor PC detection (PhoSL-HP ELISA method 1) The lectin-antibody ELISA for fucosylated haptoglobin (PhoSL-HP) was performed as described previously [11]. Briefly, a 96-well ELISA plate was coated with the Fab frag-ment of anti-human HP IgG (Dako, Carpinteria, CA, USA), because IgG has fucosylated oligosaccharides in its Fc por- WebThe lectin from a mushroom Pholiota squarrosa (PhoSL) shows a clear specificity to core fucosylation, without recognizing those with other types of fucosylation, such as the H type via the α1-2...
Phosl lectin
Did you know?
WebJul 14, 2016 · PhoSL recognizes core fucose, whereas AAL recognizes all types of fucosylation. In normal controls, serum haptoglobin is scarcely fucosylated and core fucosylation levels of haptoglobin are increased at the stage of chronic pancreatitis. WebMay 17, 2024 · The core α1–6 fucosylation-specific lectin from a mushroom Pholiota squarrosa (PhoSL) is a potential tool for precise diagnosis of cancers. This lectin consists of only 40 amino acids and can be chemically synthesized. We showed here that a synthesized PhoSL peptide formed a trimer by gel filtration and chemical cross-linking assays, and …
Web开馆时间：周一至周日7:00-22:30 周五 7:00-12:00; 我的图书馆 http://www.phosal.com/products.html
WebAug 25, 2024 · Here, we observed that the S proteins of the ancestral (Wuhan) and Omicron strains bind with Pholiota squarrosa lectin (PhoSL), a 40-amino-acid chemically synthesised peptide specific to core-fucosylated N-glycans. The affinities were at a low nanomolar level, which were ~ 1000-fold stronger than those between PhoSL and the core-fucosylated N ...
WebFOLOTYN is a chemotherapy approved by the US Food & Drug Administration (FDA) for the treatment of relapsed or refractory PTCL. Relapsed — There was initial tumor shrinkage, …
WebApr 28, 2024 · An increase in Lewis- and core-type fucosylation of haptoglobin has been reported in patients with pancreatic cancer (PC), suggesting that fucosylated haptoglobin is a candidate PC biomarker. Previously, we developed a Pholiota squarrosa lectin antibody enzyme-linked immunosorbent assay (PhoSL-ELISA) system for the detection of core … grapevine restaurants downtownWebSep 28, 2024 · To achieve the cure, new anti-HBV agents are needed. Here we found that Pholiota squarrosa lectin (PhoSL), a lectin that specifically binds core-fucose, inhibited … grapevine restaurant three chopt rdWebALC offers the broadest, most versatile line of lecithin-based products on the market. Under the world-famous ALCOLEC® trademark, American Lecithin markets a series of natural … chips basketsWebOct 5, 2012 · The purified lectin was designated as PhoSL ( P. squarrosa lectin). SDS-PAGE, MALDI-TOF mass spectrometry, and N-terminal amino acid sequencing indicate that PhoSL has a molecular mass of 4.5 kDa and consists of 40 amino acids (NH 2 -APVPVTKLVCDGDTYKCTAYLDFGDGRWVAQWDTNVFHTG-OH). Isoelectric focusing of … grapevine rheumatologyWebMar 8, 2024 · The mini fungal lectin PhoSL was recombinantly produced and characterized. Despite a length of only 40 amino acids, PhoSL exclusively recognizes N-glycans with α1,6-linked fucose. Core fucosylation influences the intrinsic properties and bioactivities of mammalian N-glycoproteins and its level is linked to various cancers. grapevine retreat west jefferson ncWebEstablishment of a novel lectin–antibody ELISA system to determine core-fucosylated haptoglobin. Author links open overlay panel Mayuka Shimomura a 1, Kotarosumitomo Nakayama a 1, Kanako Azuma a, Naoko Terao a, Kimihiro Nishino a, Shinji Takamatsu a, Miyako Nakano b, Shiro Takahashi b, Yuka Kobayashi c, Kohei Murata d, Yoshihiro … grapevine restaurant south padre island txWebMay 17, 2024 · This lectin consists of only 40 amino acids and can be chemically synthesized. We showed here that a synthesized PhoSL peptide formed a trimer by gel … grapevine rheumatology associates